PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g054390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 512aa    MW: 57477.3 Da    PI: 7.09
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g054390.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.7e-182176257
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    +kR   t+ q+ +Le+++++++yp++e++ +LA+++gLte+qV+ WF+ rR k+k+
  Csa13g054390.1 21 KKRKLKTPIQVMTLENFYNEHKYPTEEMKGKLAEEIGLTEKQVSGWFCHRRLKDKR 76
                    8999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-20476IPR009057Homeodomain-like
PROSITE profilePS5007116.5841777IPR001356Homeobox domain
SuperFamilySSF466898.13E-171983IPR009057Homeodomain-like
SMARTSM003891.1E-181981IPR001356Homeobox domain
PfamPF000461.7E-152176IPR001356Homeobox domain
CDDcd000861.46E-162177No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MNSDSGEAPA DGDKASTENS KKRKLKTPIQ VMTLENFYNE HKYPTEEMKG KLAEEIGLTE  60
KQVSGWFCHR RLKDKRSVKE DGTNIGSQDR SSVVLQDRGS GLRQDSCGST KQTDYWNPKP  120
REVESQRLYE GSYMGNADGE DSTSSERSSS LHKNFVSSKD GIRDVESSIY VTHNDVIQHP  180
QLMRSYGYNK PSGYLKVKRE SENVSITAVK RQLGRQYQTD GPPLGIQFDP LPPGAFEPQT  240
NAIVQEPIYV GNQRRPHPPH LLGTRKSFNP GPSYELARKL KMHSPDPDSE EEEEDDDNIM  300
IGMEPGLRDR KSLGEPRLKS PSPSFYNTVP NHKPFQETFK GSPRELPVTN NKKGRISSKS  360
WAEGSRNNMI ANFHNLPGSN TETNQTHNYD KKIFNGGHKT GYLTKSSKLL PPSRSRSPDS  420
IDRGPSSVMV GKFHGERNQT KTHREKLHST DEPLVTKQVE DDYLQQDYAP KSSYSEILER  480
EGQINRSGVE LPSSLSGDDD ETDESSSSSM Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412960.0AJ441296.1 Arabidopsis thaliana mRNA for homeodomain protein 14 (hd-14 gene).
GenBankBT0263720.0BT026372.1 Arabidopsis thaliana At4g03250 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010455984.10.0PREDICTED: uncharacterized protein LOC104737481
TrEMBLR0HBG10.0R0HBG1_9BRAS; Uncharacterized protein
STRINGAT4G03250.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.10.0HB-other family protein